PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA08G0048400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 192aa    MW: 20582.3 Da    PI: 10.1618
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA08G0048400.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.77e-3282137258
          CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                        ep+YVNa+Qy++Il+RRq+Rak+e+e+k  +k rkpylheSRh hAl+R+RgsgGrF
  ORGLA08G0048400.1  82 EPIYVNARQYHGILRRRQSRAKAESENKA-NKIRKPYLHESRHLHALKRARGSGGRF 137
                        8****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.0E-3379140IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.96580140IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.4E-2782137IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.4E-2483105IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.4E-24114137IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MKPDGETQLR PTAAGHPDPG LGTSSAEYVA PVGPATAPVA YPYIGTYYGG IYGAYSGQPL  60
VNAALMAMPP HSVPLVTDAV VEPIYVNARQ YHGILRRRQS RAKAESENKA NKIRKPYLHE  120
SRHLHALKRA RGSGGRFLNS KAVEGKQDTK SVDKKDGAVP SEKRDNKLAN NIIKLENSSP  180
TTQPGAVASD VV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-2080141162NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880270.0AB288027.1 Oryza sativa Japonica Group OsHAP2A mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK0599030.0AK059903.1 Oryza sativa Japonica Group cDNA clone:006-208-G09, full insert sequence.
GenBankHQ7314790.0HQ731479.1 Oryza sativa Japonica Group NF-Y transcription factor 21 (NF-Y18) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648196.11e-130PREDICTED: nuclear transcription factor Y subunit A-4 isoform X1
SwissprotQ84JP13e-38NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A0D3GX801e-138A0A0D3GX80_9ORYZ; Uncharacterized protein
TrEMBLI1QGD31e-138I1QGD3_ORYGL; Uncharacterized protein
TrEMBLA0A0E0ARX01e-138A0A0E0ARX0_9ORYZ; Uncharacterized protein
STRINGORGLA08G0048400.11e-138(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP165581313
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34720.13e-36nuclear factor Y, subunit A4